PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000194.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 616aa    MW: 67836.3 Da    PI: 4.6015
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000194.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.61.4e-5061341128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtd el+v+yLk+k+ gkkl+++e+i+e++iyk+ PwdLp k ++k+++ ewyfF++r++ky++g r nr+t++gyWk
  Itr_sc000194.1_g00003.1   6 LPPGFRFHPTDVELIVYYLKRKIMGKKLHFFEAISEINIYKFSPWDLPdKsCLKSKDLEWYFFCPRERKYNSGARMNRSTETGYWK 91 
                              79*********************************************96347788888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +tg+d++v+  ++++vg+ ktL+f++g+apkg++tdWv+heyr+
  Itr_sc000194.1_g00003.1  92 TTGRDRPVIY-NERTVGMVKTLIFHEGHAPKGNRTDWVIHEYRI 134
                              **********.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.02E-563156IPR003441NAC domain
PROSITE profilePS5100556.1826156IPR003441NAC domain
PfamPF023658.7E-257134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 616 aa     Download sequence    Send to blast
MGRTFLPPGF RFHPTDVELI VYYLKRKIMG KKLHFFEAIS EINIYKFSPW DLPDKSCLKS  60
KDLEWYFFCP RERKYNSGAR MNRSTETGYW KTTGRDRPVI YNERTVGMVK TLIFHEGHAP  120
KGNRTDWVIH EYRIEDLHME EETLTDSYVL CKVFKKSGLG PKNGAQYGAP FSEEDWEDDF  180
ENCDEPIPFS IPPHPINQNC SSVTSMIDPG CSSRQPSSEP GPSAIPPAKL SDPINQNCSS  240
VTVGMIDAGC ASHQPSAEPG PYATPPTKLA DPINQNCSSV TGGMIDPGCS SHQPSAEPDP  300
SAVPPAKHED PINQNCTSVA DMIDAGCSSR QPSNEPGPSL SRHEMPPTNQ NCSVFMGTVN  360
PGNTCSQSLA KPGPSLAVPH SSEVPPDDDI SHLFASFLED TDLIPIENNE DFNCCNQGLN  420
VDMMPCMDGN DIYTAFGGCD NFADLSGGRS YLSGSLVADH PPNSLFPQDD ASFLELNDLL  480
MPVDHCTRTS EAHPLVEENL YSSNVPFLVM EHFNYGGNFS GGNQFIPTQS QLQVLPQHYT  540
QQVTGIGFNA SQGYNTMQVT GMEFNASQGY DAMQVSGIEF NAGQGYNIPY NYGFDTTMHQ  600
HGMITSHAAD RDQHRG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-46615615168Stress-induced transcription factor NAC1
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60502334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64060.13e-84NAC domain containing protein 103